PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009803234.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Nin-like
Protein Properties Length: 1019aa    MW: 111289 Da    PI: 5.4887
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009803234.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK92.43.3e-29613664152
          RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                     aek+isle+l++yF++++kdAAk+Lgvc+T++KriCRq+GI+RWP+Rki+++
  XP_009803234.1 613 AEKTISLEVLQQYFAGSLKDAAKSLGVCPTTMKRICRQHGISRWPSRKINKV 664
                     589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.53603684IPR003035RWP-RK domain
PfamPF020423.5E-26616664IPR003035RWP-RK domain
SuperFamilySSF542771.28E-189231009No hitNo description
PROSITE profilePS5174518.9539241006IPR000270PB1 domain
SMARTSM006664.6E-209241006IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2402.6E-209251005No hitNo description
PfamPF005641.5E-159251005IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 1019 aa     Download sequence    Send to blast
MAEPEEKITS KYLPTKSKEF SPPPPPQQSP YTAAARESTT MMMDLDLDID ASWSFDQIFA  60
AAAAVSSNPA SPFLPCSPLW AFSDDIDEKP AGNSFSGALR LSSHPRFGAT YTDDPEATTE  120
TVSVNADKGR LPSPILELAP RDYPNGSCII KERMTQALRY FKESTGERVL AQVWAPVKDA  180
GRYVLTTSGQ PFVLDPDCNG LHQYRTVSLM YMFAADGETG GVLGLPGRVF RLKLPEWTPN  240
VQYYSSKEFP RLDHALHYNV RGTLALPVFE PSGQSCLGVL ELIMTSQKIN YAAEVDKVCK  300
ALETVNLKSS EILDHPNTQV YVMGYMNQIC NEGRQNALVE ILEILTAVCE TYQLPLAQTW  360
VPCRHRSVLA DGGGLKKSCS SFDGSCMGQI CMSTTDVAFY VVDAHMWGFR EACAEHHLQK  420
GQGVAGRAYA SQKSCFCEDI TQFCKTEYPL VHYARLFGLT SCFAICLRSS HTGNDDYILE  480
FFLPPNSGDY SDQQALLNSL LLTMKQHFRS LSIASGEELE HDWSSVEIIK ASMEEKIDAK  540
PESVPAPKSL PQPTRLPNGR THLDPLGEQQ FSVESDVAKG AGSKSGTGEA PNHISPSDNK  600
PTGKKSERKR GKAEKTISLE VLQQYFAGSL KDAAKSLGVC PTTMKRICRQ HGISRWPSRK  660
INKVNRSLSK LKCVIESVQG TEGAFTLTSL APNSLPTAVG SISWPACASG SNLPSSPLSK  720
PSVFHEEKNE FSNHGTPESH EEAEPSNQML GGRVTRKEEF IPQNGSLRAE GSHKSRTGSV  780
SREESAGTPT SQGSCQGSPS AGNEFSPQND LVNSPAHEAC MKVGGSLEAA HQTTTENNLA  840
AAFLIPRPFI PERAQEPFGG MLVEDAGSSH DLRNLCPAGD ALVDECVPEY GLQNPPFSDK  900
IAKDPVYVPA DTLPQYSAWP EVTFVTIKAA YREDIIRFRL CLNSGIVKLN EEVAKRLKLE  960
LGTFDIKYRD DDLELVSISC DADLQEYVDI SLSSGSSIVR LLVHDIMSNL GSSCESSGK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755200.0HG975520.1 Solanum lycopersicum chromosome ch08, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009803234.10.0PREDICTED: protein NLP7-like isoform X1
RefseqXP_016478548.10.0PREDICTED: protein NLP7-like isoform X1
SwissprotQ84TH90.0NLP7_ARATH; Protein NLP7
TrEMBLM1A4Z40.0M1A4Z4_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000148370.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA52232239
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24020.10.0NIN like protein 7